PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA82G00015
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 429aa    MW: 49288.4 Da    PI: 10.4771
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA82G00015genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.47.1e-1516881695
                EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
          B3 16 lvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                 ++pk f+ +h +g   e+k+++l++  s  +W+vk+  ++++    l+ GW+eF+ a++Lk gD+++Fk++++ +f  +v+
  AA82G00015 16 TMIPKAFFLKHiKGR-YEQKMVKLRSdASKLTWRVKI--DGRR----LSYGWEEFCVAHDLKIGDIIIFKHEKDLCF--HVT 88
                58******9997444.466799999978889******..9998....899********************9887777..665 PP

2B3573.5e-181702471694
                 EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
          B3  16 lvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                  +lp  f++e+g++ke+ k+++l+  +s+++W++ l+ +k  g++++++GW++F++ ngLk+  +++Fkl++r +++lv+
  AA82G00015 170 QYLPQGFVRENGINKERFKEIVLMGeKSSKTWNFALR-QKICGTFYIRRGWRSFCSYNGLKVENSFTFKLTKR-GTTLVL 247
                 589**********************5666*******4.666667*************************9874.444454 PP

3B357.82e-18337426899
                 -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
          B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                 + v++s+   lp +fa+++++k  e+++++l d++g +W+  l+ + ++ r  + +GWk+F++ang+k+g+++ ++l+++++++ v+++++k
  AA82G00015 337 KPVFESCVQALPVRFARANDIK--EGTQMSLLDKHGVKWSTDLRSEANGPRLRMVGGWKGFCHANGVKTGESFKLELVWEENTTAVLRFCSK 426
                 679999999**********988..5668***************99899999999**************************999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.9E-19395IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-18399IPR015300DNA-binding pseudobarrel domain
CDDcd100171.38E-13590No hitNo description
SMARTSM010195.9E-20693IPR003340B3 DNA binding domain
PfamPF023624.4E-101785IPR003340B3 DNA binding domain
PROSITE profilePS5086310.6591893IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-15158248IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.1E-14160253IPR003340B3 DNA binding domain
SuperFamilySSF1019361.67E-13160248IPR015300DNA-binding pseudobarrel domain
PfamPF023621.4E-16170248IPR003340B3 DNA binding domain
CDDcd100171.17E-11171249No hitNo description
PROSITE profilePS5086312.097172252IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.5E-17297426IPR015300DNA-binding pseudobarrel domain
CDDcd100171.67E-14334424No hitNo description
SMARTSM010192.7E-18335427IPR003340B3 DNA binding domain
SuperFamilySSF1019369.61E-17335425IPR015300DNA-binding pseudobarrel domain
PfamPF023622.5E-17337426IPR003340B3 DNA binding domain
PROSITE profilePS5086312.125347426IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MANQHFFKPL LPGFHTMIPK AFFLKHIKGR YEQKMVKLRS DASKLTWRVK IDGRRLSYGW  60
EEFCVAHDLK IGDIIIFKHE KDLCFHVTPF GPSCCEIQYT NNHLGKKNPR RETDSSVGHS  120
NYFVAKISTS SLRYDMLVHN PLLFPNKPKL IFSFHCINCF LTLFFVMNLQ YLPQGFVREN  180
GINKERFKEI VLMGEKSSKT WNFALRQKIC GTFYIRRGWR SFCSYNGLKV ENSFTFKLTK  240
RGTTLVLRLS GAIAKEDDMK TTVCLSTESE SGSDEKRISR ESLGRKVTMG KVKWRASSSS  300
AENRFLTLNL RPVYVKNNLL VTIQTGTKFV NSPKILKPVF ESCVQALPVR FARANDIKEG  360
TQMSLLDKHG VKWSTDLRSE ANGPRLRMVG GWKGFCHANG VKTGESFKLE LVWEENTTAV  420
LRFCSKVKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.13e-94B3 family protein